PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00065.1.g01580.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 555aa    MW: 60259.8 Da    PI: 8.8715
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00065.1.g01580.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding574.4e-18195241148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT+eEd+ l + v+++G + W+ +ar+++ gR +kqc++rw ++l
  Zjn_sc00065.1.g01580.1.am.mk 195 KGPWTAEEDDVLREMVREHGDRKWAVVARYLP-GRIGKQCRERWTNHL 241
                                   79******************************.************996 PP

2Myb_DNA-binding52.98.3e-17249289345
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                    WT+e+d+ l++a+k +G++ W+ Iar ++ gR+++++k++w+
  Zjn_sc00065.1.g01580.1.am.mk 249 LWTEEDDLALIEAHKVYGNR-WSMIARFLP-GRSENSVKNHWN 289
                                   5*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.646190245IPR017930Myb domain
SMARTSM007179.8E-18194243IPR001005SANT/Myb domain
SuperFamilySSF466891.27E-30194288IPR009057Homeodomain-like
PfamPF002496.8E-17195241IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-24196246IPR009057Homeodomain-like
CDDcd001671.27E-15197241No hitNo description
PROSITE profilePS5129420.986246296IPR017930Myb domain
SMARTSM007171.3E-15246294IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-20247291IPR009057Homeodomain-like
PfamPF002494.6E-14249289IPR001005SANT/Myb domain
CDDcd001671.04E-13250289No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MGSLHVMQAL TRCYYMDRHG VCEPERWVRH RRHVSSAGQR MGRLGKPRGG MDTGRRMRMV  60
ADDLDGRRCP CSLYIFRPPD RQCSISLASC DRSSPPRPAS FLPPCLDDRE PRMEAESSLR  120
FVQDVSAAAA VHPGNVARAV PAAAGMLRPS MGALLAGFGM APSGMFLPGR PPAPSPAQPR  180
AGSGHGERAP APAQKGPWTA EEDDVLREMV REHGDRKWAV VARYLPGRIG KQCRERWTNH  240
LRPDIKKSLW TEEDDLALIE AHKVYGNRWS MIARFLPGRS ENSVKNHWNA TRRSLKAKRR  300
LKKKRNAAQP TSPPGVDHCS VLEEYIRGVY PAAAADPAAP SPSVSPPSYN LAYGDAVSPP  360
PAATAGGLFD PAAAAAAGMG IMMYHNPGAS GISSSASPPS SNAGTAATDN VNNVPPPLML  420
DLNAYYGEAP LHAMRKPPPP AQMMMMMFNH HDQHQQQHQA SSAYYTNLLS YPSFFDSFTW  480
QPSSSVVHGS GSGDISNNNA NNAGGDHHQY YESEHAASGG GGSGRDDDAD VVQMASREFL  540
TPSPDEMNLN LARFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-431952917103B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001132209.12e-93uncharacterized protein LOC100193638
TrEMBLB4FFS12e-93B4FFS1_MAIZE; Uncharacterized protein
STRINGSb01g013830.14e-91(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.12e-41myb domain protein 119